PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 202aa    MW: 22020.9 Da    PI: 5.5699
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016465genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.73.9e-38141131100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+rkC++dC +apyfp e+ ++f  vhk+FGa++v+kll+++ +++r++++sslv eA+ar+rdPvyG++g i+ lq q+e+l++el++++
  DCAR_016465  14 PCAACKFLKRKCQPDCNFAPYFPPEELQNFISVHKIFGATRVSKLLNEVLPHQRHETVSSLVCEAQARLRDPVYGSFGAISILQLQVERLQKELDEAN 111
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  DCAR_016465 112 AE 113
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.89713114IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-3714111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAASFKVVQY NYSPCAACKF LKRKCQPDCN FAPYFPPEEL QNFISVHKIF GATRVSKLLN  60
EVLPHQRHET VSSLVCEAQA RLRDPVYGSF GAISILQLQV ERLQKELDEA NAELVNYACG  120
YNHCCCHLDT GGTTAALPAP SAVPENSMCD YAQIPPQIRP VDLIDTGEAG VFNYYQTPSS  180
STFPWNDTNV PNLGGAAGQG L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1483974e-60FJ148397.1 Daucus carota subsp. sativus clone BAC C055M03 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476856.11e-56PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_006476857.11e-56PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_006476858.11e-56PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_015385245.11e-56PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML47e-50LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW91e-56B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.14e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-51LBD family protein